Protein Info for MPMX20_03427 in Enterobacter sp. TBS_079

Annotation: Membrane-bound lytic murein transglycosylase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00497: SBP_bac_3" amino acids 46 to 268 (223 residues), 74.7 bits, see alignment E=6.3e-25 PF01464: SLT" amino acids 297 to 402 (106 residues), 77.5 bits, see alignment E=6.2e-26

Best Hits

Swiss-Prot: 90% identical to MLTF_ENT38: Membrane-bound lytic murein transglycosylase F (mltF) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_03895)

MetaCyc: 82% identical to membrane-bound lytic murein transglycosylase F (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Transglycosylase, Slt family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>MPMX20_03427 Membrane-bound lytic murein transglycosylase F (Enterobacter sp. TBS_079)
MKKLKINYLLIGIVTLLLAVALWPSIPWFGKAENRIAAIQERGELRVSTLNSPLIYSDIN
GKTIGLDYELAQQFADYLGVKLKITVRQNISQLFDDLDNNDADILAAGLVYNSERSKNYQ
PGPTYYSVSQQLVYRVGSLRPRTLAAINAQQLTIAPGHVVIDDLRELKEKKFPDLSWTVD
PKLGTTELLDQVKDKKLPYTIADSVAISLFQRVHPEIAVALDVTDEQPVTWFSQLDDDQT
LSAAMLDFFNTINEDGTLARLEEKYLGHGDDFDYVDTRSFLRAVDSVLPDLQPLFEKYAQ
EIDWRLLAAISYQESHWDTQATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYL
QDMMGKVPETVPEEERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWSDVKQRLPLLSQ
KPWYNKLTYGYARGHEAYAYVENIRKYQISLVGYLLEKEKEAAEANQLAQSYPVVAPDEL
TRPTTSILPFVAFSADGAFERNHLIAPHTLVQVPHR