Protein Info for MPMX20_03418 in Enterobacter sp. TBS_079

Annotation: putative 3-phenylpropionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 356 to 373 (18 residues), see Phobius details PF12832: MFS_1_like" amino acids 8 to 359 (352 residues), 191.6 bits, see alignment E=4.6e-60 PF01306: LacY_symp" amino acids 9 to 366 (358 residues), 47.3 bits, see alignment E=2.8e-16 PF07690: MFS_1" amino acids 9 to 315 (307 residues), 59.2 bits, see alignment E=7.2e-20 PF03825: Nuc_H_symport" amino acids 11 to 306 (296 residues), 45.3 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 84% identical to HCAT_ECOLI: Probable 3-phenylpropionic acid transporter (hcaT) from Escherichia coli (strain K12)

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 99% identity to enc:ECL_03886)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MPMX20_03418 putative 3-phenylpropionic acid transporter (Enterobacter sp. TBS_079)
MVLHSTRWLALSYFTYFFSYGIFLPFWSVWLKGIGLTPETIGILLGAGLVARFLGSLLIA
PRVSDPSLLIKAVRILALLTLVFVACFWVSHQFAWLMVVMVGFNLFFSPLVPLTDALANT
WQKQITMDYGRVRLWGSIAFVIGSALVGKLVSLYDYRAILALLSIGIASMLLGMLLRPSV
MPQGESRHQESAGWPAWRSLVAQSWRFLACVCLLQGAHAAYYGFSAIYWQGAGYSASAVG
YLWSLGVVAEVIIFALSKKLFRRFGARDLLLLSAVCGVIRWGIMGWTTELPWLIVAQILH
CGTFTVCHLAAMRYIAAREGGDVIRLQSVYSAVAMGGSIAVMTVFAGFLYQHLGHGVFWV
MALVALPAMFVRPKVAARA