Protein Info for MPMX20_03400 in Enterobacter sp. TBS_079

Annotation: Maltose-6'-phosphate glucosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF02056: Glyco_hydro_4" amino acids 9 to 186 (178 residues), 167.7 bits, see alignment E=2.1e-53 PF11975: Glyco_hydro_4C" amino acids 197 to 419 (223 residues), 186.7 bits, see alignment E=5.6e-59

Best Hits

Swiss-Prot: 46% identical to PAGL1_LACP3: 6-phospho-alpha-glucosidase 1 (simA) from Lactobacillus paracasei (strain ATCC 334 / BCRC 17002 / CIP 107868 / KCTC 3260 / NRRL B-441)

KEGG orthology group: K01232, maltose-6'-phosphate glucosidase [EC: 3.2.1.122] (inferred from 97% identity to enc:ECL_03868)

Predicted SEED Role

"Maltose-6'-phosphate glucosidase (EC 3.2.1.122)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization (EC 3.2.1.122)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.122

Use Curated BLAST to search for 3.2.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>MPMX20_03400 Maltose-6'-phosphate glucosidase (Enterobacter sp. TBS_079)
MFTPPFILSIAGGGSTYTPGIVKSLMVRLQDFPLAEIRLYDIDEARQNTIAPVVEKVIRD
HSQSITFTVTTDPEVAFSGAHFVFAQMRVGQYRMREQDEKIPLRHGVVGQETCGPGGLAY
GLRTILPMVELIDLVDRYAHEKAWIVNYSNPAAIVAEGVRRLRPDARVLNICDMPVAAMR
NMGAILGVDRHKLEVDYFGLNHFGWFTRVRVDGEDKLPELRRHIARFGLLTEDAAKTDPQ
HSDPSWVKTWRNIKPIMDNFPEYLPNPYLQYYLMPNQIVEHQNPDYTRANEVMNGREKKL
FAAAEEYKRTGILPDAFHVGVHGEFIVDVACSLAFNLRQRHLVMVENRGAITNLPYDAVV
EVPAYITSEGPEPIRVGRVPLFHQTLLQQQLASEQLLVEATIEGSYEKALQAFTLNRTVP
TMEHAKAILDEMIDANRDYWPALQKAWQNGEAVKK