Protein Info for MPMX20_03395 in Enterobacter sp. TBS_079

Annotation: Dual-specificity RNA methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 18 to 373 (356 residues), 588 bits, E=3e-181
• PF21016: RlmN_N
  • amino acids 22 to 81 (60 residues), 106.6 bits, E=4.2e-35
• PF04055: Radical_SAM
  • amino acids 124 to 297 (174 residues), 66 bits, E=4.9e-22

Best Hits

Swiss-Prot: 97% identical to RLMN_ENT38: Dual-specificity RNA methyltransferase RlmN (rlmN) from Enterobacter sp. (strain 638)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 98% identity to enc:ECL_03859)

MetaCyc: 93% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Protein Sequence (388 amino acids)

>MPMX20_03395 Dual-specificity RNA methyltransferase RlmN (Enterobacter sp. TBS_079)
MSELVNTSEVAIPAVPNKNGKINLLDLNRQQMREFFKEMGEKPFRADQVMKWMYHYCSDN
FDDMTDINKVLRNKLKEVAEIRAPKVVEEQRSADGTIKWAIAVGDQRVETVYIPEEDRAT
LCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTGTRPITNVVMM
GMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHA
PNDEIRDEIVPINKKYNIETFLAAVRRYLEKSNANQGRVTIEYVMLDHVNDGTEHAHQLA
ELLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMEYGFTTIVRKTRGDDIDAACG
QLAGDVIDRTKRTLRKRMQGETIAVKAV