Protein Info for MPMX20_03370 in Enterobacter sp. TBS_079

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 329 (278 residues), 151.5 bits, see alignment E=1.3e-48

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to enc:ECL_03804)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>MPMX20_03370 Ribose import permease protein RbsC (Enterobacter sp. TBS_079)
MTQMISKTQVPVKRSGRLDPIAFFERFGVLIFMILLLIFFQSQNSNFFSERNIFNILTEV
SIYGIMAVGMTFVILTAGIDLSVGSILAVCAMTAAYVIKGDNFTTVDPNAWGGMSWLIGL
GICLAMGTAIGFLHGLGVTRLRLPPFIVTLGGMTIWRGLTLVINDGAPIAGFDPGYRWWG
RGELLGISIPIWIFAIVALGGYLALHKTRWGRFVYAIGGNPEAARLAGVNVKRVLVSVYV
LIGCLAGLAGFILSARLGSAEAVAGISFELRVIASVVIGGTSLMGGYGRIGGTIIGSIIM
GILINGLVLMNVSAYYQQIITGLIIVLAVAFDTYAKSRRGAL