Protein Info for MPMX20_03343 in Enterobacter sp. TBS_079

Annotation: Putative transport protein YhhT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 20 to 52 (33 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 240 to 270 (31 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 332 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 20 to 345 (326 residues), 292.3 bits, see alignment E=2.4e-91

Best Hits

Swiss-Prot: 93% identical to PERM_ECOLI: Putative permease PerM (perM) from Escherichia coli (strain K12)

KEGG orthology group: K03548, putative permease (inferred from 99% identity to enc:ECL_03779)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>MPMX20_03343 Putative transport protein YhhT (Enterobacter sp. TBS_079)
MLEMLMQWYRRRFSDPEAIALLVILVAGFGILFFFSGLLAPLLVAIVLAYLLEWPTARLE
NIGCSRRWATSIVLVLFVGILLLMSFVVMPVAWQQGIYLIRDMPGMLNKLSDFAATLPRR
YPALMDAGIIDAMAENMRARIMTMGDSVVKYSLASLVGLLTLAVYLVLVPLMVFFLVKDK
EQMLNAVRRILPRNRGLAGQVWEEMNQQITNYIRGKVLEMIVVGVATWIGFLIFGLNYSL
LLAVLVGLSVLIPYIGAFVVTIPVVGVALFQFGLGTEFWSCFAVYLIIQGLDGNLLVPVL
FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVVHAWPDVPAVEDK