Protein Info for MPMX20_03339 in Enterobacter sp. TBS_079

Annotation: Outer membrane protein assembly factor BamC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF06804: Lipoprotein_18" amino acids 40 to 342 (303 residues), 366.7 bits, see alignment E=4.3e-114

Best Hits

Swiss-Prot: 88% identical to BAMC_ECOLI: Outer membrane protein assembly factor BamC (bamC) from Escherichia coli (strain K12)

KEGG orthology group: K07287, lipoprotein-34 (inferred from 97% identity to enc:ECL_03775)

Predicted SEED Role

"Outer membrane protein NlpB, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and YfgL); Lipoprotein-34 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>MPMX20_03339 Outer membrane protein assembly factor BamC (Enterobacter sp. TBS_079)
MAYSVQKSRLAKVASVSLVMLLAACSSDSRYKRQVSGDESYLDATPLAELHAPAGMILPI
QNGDYNIPVTNGSGLVGKALDIRPPAQPLALVSGARTQFTGDTASLLVESARGTTLWPQV
VSVIQAKNYTIDKRDDASQTLTTDWIEWNRLDEDQQYRGRYQVSVKPQGYQQAVTVKLLN
LEQAGKPVADAASMQRYSTEMLNVIAAGLDKNASDAANAAQSRNGATFDVQSGADDTGLP
MLVVRAPFNQTWQRLPATLEKVGMKVTDSTRSTGSMTATYKPLSDSAWQELGATDPQLAS
GDYKIQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFSK