Protein Info for MPMX20_03328 in Enterobacter sp. TBS_079

Annotation: GDP-mannose pyrophosphatase NudK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 7 to 186 (180 residues), 239.5 bits, E=1e-75
• PF00293: NUDIX
  • amino acids 45 to 163 (119 residues), 42.6 bits, E=3e-15

Best Hits

Swiss-Prot: 85% identical to NUDK_ENT38: GDP-mannose pyrophosphatase NudK (nudK) from Enterobacter sp. (strain 638)

KEGG orthology group: K12945, GDP-mannose pyrophosphatase NudK [EC: 3.6.1.-] (inferred from 92% identity to enc:ECL_03764)

MetaCyc: 80% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"GDP-mannose pyrophosphatase YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (196 amino acids)

>MPMX20_03328 GDP-mannose pyrophosphatase NudK (Enterobacter sp. TBS_079)
MTLKIDVIKDKILSENYFVLRNITYDLTRNNGEVIRHKREVYDRGNGATILLYNREKQSV
VLIRQFRVATWVNGNPDGRLIETCAGLLDDDEPEVCIRKEAVEETGFEVGEVKKVFELFM
SPGGVTEIVHFFIAEYSDAQRTHRGGGVEDEDIEVLELPFSRALEMMHAGEIRDGKAVIL
LQYLQTTGLMNASFER