Protein Info for MPMX20_03242 in Enterobacter sp. TBS_079

Annotation: Histidine transport system permease protein HisM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 167 to 180 (14 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 122 (102 residues), 48.8 bits, see alignment E=4.2e-17 PF00528: BPD_transp_1" amino acids 37 to 221 (185 residues), 57.6 bits, see alignment E=7.4e-20

Best Hits

Swiss-Prot: 92% identical to HISM_SHIFL: Histidine transport system permease protein HisM (hisM) from Shigella flexneri

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 100% identity to enc:ECL_03656)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MPMX20_03242 Histidine transport system permease protein HisM (Enterobacter sp. TBS_079)
MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGILAVFLAIGRVSNNKFIQFPIW
LFTYVFRGTPLYVQLLVFYSGMYTLEIVKGTEMLNAFFRSGLNCTVLALTLNTCAYTTEI
FAGAIRSVPYGEIEAARAYGFSSVKLYRCIILPSALRIALPAYSNEVILMLHSTALAFTA
TVPDLLKIARDINSATYQPFTAFGIAAVLYLIISYVLISLFRKAEKRWLQHIKPSSTH