Protein Info for MPMX20_03210 in Enterobacter sp. TBS_079

Annotation: NADH-quinone oxidoreductase subunit J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details PF00499: Oxidored_q3" amino acids 16 to 157 (142 residues), 129.6 bits, see alignment E=3.9e-42

Best Hits

Swiss-Prot: 96% identical to NUOJ_ECO57: NADH-quinone oxidoreductase subunit J (nuoJ) from Escherichia coli O157:H7

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to enc:ECL_03624)

MetaCyc: 96% identical to NADH:quinone oxidoreductase subunit J (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>MPMX20_03210 NADH-quinone oxidoreductase subunit J (Enterobacter sp. TBS_079)
MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFALGAHFAGALEIIVYA
GAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGID
GTPIGAKEVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGELLSNRTDDRAKRKT
EERA