Protein Info for MPMX20_03203 in Enterobacter sp. TBS_079

Annotation: Protein ElaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00583: Acetyltransf_1" amino acids 21 to 129 (109 residues), 33.2 bits, see alignment E=8.2e-12 PF13673: Acetyltransf_10" amino acids 44 to 149 (106 residues), 55.4 bits, see alignment E=9.7e-19 PF13508: Acetyltransf_7" amino acids 50 to 130 (81 residues), 29.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 77% identical to ELAA_SHIFL: Protein ElaA (elaA) from Shigella flexneri

KEGG orthology group: K02348, ElaA protein (inferred from 88% identity to ent:Ent638_2817)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>MPMX20_03203 Protein ElaA (Enterobacter sp. TBS_079)
MIQWQDLHHSELTVTSLYALLKLRCEVFVVEQTCPYQDIDGDDLIGENRHILGWRDNALV
AYARILKSEDDFEPVVIGRVIISGNARGEKLGYQLMEKTLEACQKQWPDKALYLGAQAHL
QPFYGHFGFTPVTEVYDEDGIPHIGMAREAKQA