Protein Info for MPMX20_03201 in Enterobacter sp. TBS_079

Annotation: Isochorismate synthase MenF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00543: isochorismate synthase
  • amino acids 93 to 427 (335 residues), 362.6 bits, E=1.2e-112
• PF00425: Chorismate_bind
  • amino acids 169 to 420 (252 residues), 242 bits, E=3.9e-76

Best Hits

Swiss-Prot: 66% identical to MENF_ECOLI: Isochorismate synthase MenF (menF) from Escherichia coli (strain K12)

KEGG orthology group: K02552, menaquinone-specific isochorismate synthase [EC: 5.4.4.2] (inferred from 86% identity to enc:ECL_03615)

MetaCyc: 66% identical to isochorismate synthase MenF (Escherichia coli K-12 substr. MG1655)
Isochorismate synthase. [EC: 5.4.4.2]

Predicted SEED Role

"Menaquinone-specific isochorismate synthase (EC 5.4.4.2)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 5.4.4.2)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• 2,3-dihydroxybenzoate biosynthesis (3/3 steps found)
• salicylate biosynthesis II (2/3 steps found)
• salicylate biosynthesis I (1/2 steps found)
• enterobactin biosynthesis (7/11 steps found)
• vibriobactin biosynthesis (4/9 steps found)
• bacillibactin biosynthesis (6/12 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of siderophore group nonribosomal peptides
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.4.2

Use Curated BLAST to search for 5.4.4.2

Protein Sequence (431 amino acids)

>MPMX20_03201 Isochorismate synthase MenF (Enterobacter sp. TBS_079)
MNSISTALEHLRSQLTQALPTAPGLHHFDVSFPLNDAFDPLAWLGVQHCYPQFYWQQRNG
DEELAALGAVAHFSSLACASQFLQAHDAARDTRICGLNAFNPEQGSLFLPRLLWRRTAGQ
ATLRLQLWSDSSLHDDARAALDFLQQLGEARPIRPLSVEVVQEKHHPEQPEWLRLIRKAT
QTIARGDFEKVVLARATDLQFKHSVNPVALMAASRALNLNCYHFCMVFDASNAFLGSTPE
RLWRRRGKLLRTEALAGTVASHTDDKQAERLGDWLMNDDKNQRENMLVVEDICQRLQHHT
QTLEVLPAQVVRLRKVQHLRRCIWTELKHADDAQCLHVLQPTAAVAGLPRQAARDFIHHN
EPFDREWYAGSAGYLSPEQSEFCVALRSARVYEDALRLYAGAGIVSGSDPEQEWQEIENK
AAGLRSLLLRD