Protein Info for MPMX20_03197 in Enterobacter sp. TBS_079

Annotation: o-succinylbenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21508: MenC_N
  • amino acids 1 to 95 (95 residues), 133.1 bits, E=3.3e-43
• TIGR01927: o-succinylbenzoate synthase
  • amino acids 7 to 307 (301 residues), 397.8 bits, E=1.7e-123
• PF13378: MR_MLE_C
  • amino acids 127 to 282 (156 residues), 58 bits, E=1.1e-19

Best Hits

Swiss-Prot: 83% identical to MENC_ENT38: o-succinylbenzoate synthase (menC) from Enterobacter sp. (strain 638)

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 89% identity to enc:ECL_03611)

MetaCyc: 80% identical to o-succinylbenzoate synthase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate synthase. [EC: 4.2.1.113]

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Protein Sequence (321 amino acids)

>MPMX20_03197 o-succinylbenzoate synthase (Enterobacter sp. TBS_079)
MRRAQVYRWQIPMDAGVVLRERRLKTRDGMLVHLQQGEQEGWGEISPLPGFSLESLEDAQ
AVLRAWASEWREGANPALPEVPSAAFGISCALAELDGSLPAEANYRAAPLCTGDPDELFA
LLAAMPGEKVAKIKVGLYEAVRDGMVANLLLEALPDLHLRLDANRAWTPLKAQQFAKYVN
PAYRSRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREDGFAFVAEPGVRAAVIKPTLT
GSLAKVREQVAAAHAAGLTAVISSSIESSLGLTQLARIAAWLTPDTVPGLDTLNLMQNQL
IRPWPDSTLPLLDVEGLEPLL