Protein Info for MPMX20_03189 in Enterobacter sp. TBS_079

Annotation: Nicotinamide-nucleotide amidohydrolase PncC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 396 (396 residues), 534.6 bits, see alignment E=1.4e-164 TIGR00177: molybdenum cofactor synthesis domain" amino acids 2 to 167 (166 residues), 116.4 bits, see alignment E=1.1e-37 PF00994: MoCF_biosynth" amino acids 6 to 170 (165 residues), 118.2 bits, see alignment E=1.2e-38

Best Hits

Swiss-Prot: 82% identical to CINAL_ECOLI: NMN amidohydrolase-like protein YfaY (yfaY) from Escherichia coli (strain K12)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 94% identity to enc:ECL_03536)

Predicted SEED Role

"Competence/damage-inducible protein CinA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>MPMX20_03189 Nicotinamide-nucleotide amidohydrolase PncC (Enterobacter sp. TBS_079)
MINVEMLSTGDEVLHGQIIDTNAAWLADLFFEQGLPLTRRNTVGDNLESLVNVLRERSEH
ADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHEEWLAQMERFFSERGRVMAPSNRKQAE
IPASAELVDNPVGTACGFAITLNRCLMFFTPGVPSEFKVMVEQQILPRLRERFTLPEPPL
CLRLTTFGRSESDLAQSLDHLSLPPGVSMGYRSSMPIIELKLTGPASEKAAMLALWPEVQ
RVAGESLIFEGTEGLPAQIASHLQSRQLSVTLSEQFTGGLLALQLSRASAPLLASEVVPF
QQETLAQTARWASERRVKHFAGLALFVGGLDEEHLNFALATPEGTYALRVKMSITRHSLA
VRQEVCAMMALNMLRRWLMGKEVASEHGWINVVESLFVE