Protein Info for MPMX20_03170 in Enterobacter sp. TBS_079

Annotation: Magnesium transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 315 to 332 (18 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 417 to 441 (25 residues), see Phobius details amino acids 452 to 477 (26 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 55 to 477 (423 residues), 262.9 bits, see alignment E=2.6e-82 PF03448: MgtE_N" amino acids 62 to 162 (101 residues), 85.7 bits, see alignment E=4.5e-28 PF00571: CBS" amino acids 229 to 283 (55 residues), 30.4 bits, see alignment 6e-11 PF01769: MgtE" amino acids 349 to 472 (124 residues), 110.9 bits, see alignment E=7.8e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 99% identity to enc:ECL_03514)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>MPMX20_03170 Magnesium transporter MgtE (Enterobacter sp. TBS_079)
MSVLKKNSARQRDQERARLIWLLTTDKAVTSALLGKLTLAEQYDVGTLADDIAEVGALVA
HLPPPDLADTLEALPSEERHALWRLVQDHERGQVLLEASENVWDDLIDEMSDRDILDALQ
TLDIDEQIYLVQHLPRNLTGRLLASLPADERARVRQVMHYDKHSVGAIMEFGVITVRPDV
TLGTVQRYLRRLGSMPDNTDKLFVTSRDKTLLGELELKTILLNSTQRRVSEVMENEPMVF
SPEDDAEKAARTFERDDLVSAAVVDSVGKLMGRLTIDEIVDVVYEETDNDLRALGGISAE
DDVHASVGKAVKTRWAWLAINLCTAFIASRVIDGFEHTISQLVALASLMPIVAGIGGNTG
NQTITMIVRALALENIQPGNFAFLIFREMGVALINGLVWGGIMGGITWWLYDDMALGGVM
MLAMVLNLLVASMMGVIIPLTMTKLGRDPAVGSSVMITAITDTGGFFIFLGLATLFLL