Protein Info for MPMX20_03093 in Enterobacter sp. TBS_079

Annotation: Sensor histidine kinase BtsS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 30 to 198 (169 residues), 203.2 bits, see alignment E=4.5e-64 PF13185: GAF_2" amino acids 245 to 354 (110 residues), 30.3 bits, see alignment E=8.9e-11 PF06580: His_kinase" amino acids 373 to 450 (78 residues), 88.1 bits, see alignment E=7.6e-29

Best Hits

Swiss-Prot: 88% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 98% identity to enc:ECL_03436)

MetaCyc: 88% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>MPMX20_03093 Sensor histidine kinase BtsS (Enterobacter sp. TBS_079)
MSMYEFNLVLLLLQQMCVFLVIAWLMSKTRLFIPLMQVTVRLPHKLLCYVTFSIFCIMGT
YFGLHIEDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEG
LLGGLVHSYMIKRGRPDKVFSPLTAGAITFVAEMAQMAIILLIARPFEDALHLVSNIAAP
MMVTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEENSMKVAQV
LYKELDIGAVAITDRERLLAFTGTGDDHHLPGKPISSAYTLRAIETGEVVYADGNEVPYR
CSLHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAG
QYERQKALLTQSEIKLLHAQVNPHFLFNALNTLKAVIRRDSDQAAQLVQFLSTFFRKNLK
RPSEIVTLADEIEHVNAYLQIEQARFQTRLQVSLSVPDELAYQHLPAFTLQPIVENAIKH
GTSQLLGIGEITISASRFNHHLVLDIEDNAGLYVPSTSGGLGMSLVDKRLRAHFGDDCGI
TIACEPDRFTRITLRLPLEENAC