Protein Info for MPMX20_03067 in Enterobacter sp. TBS_079

Annotation: 23S rRNA 5-hydroxycytidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 11 to 347 (337 residues), 362.8 bits, E=1.2e-112
• PF16325: Peptidase_U32_C
  • amino acids 359 to 440 (82 residues), 81.4 bits, E=4.2e-27

Best Hits

Swiss-Prot: 92% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 99% identity to enc:ECL_03407)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (453 amino acids)

>MPMX20_03067 23S rRNA 5-hydroxycytidine synthase (Enterobacter sp. TBS_079)
MFKPELLSPAGTLQNMRYAFAYGADAVYAGQPRYSLRVRNNEFNHENLQLGINEAHALGK
KFYVVVNIAPHNAKLKTFIRDLKPVVDMGPDALIMSDPGLIMLVRENFPEMDIHLSVQAN
AVNWATVKFWKQMGLTRVILSRELSLEEIEEIRTQVPDMEIEIFVHGALCMAYSGRCLLS
GYINKRDPNQGTCTNACRWEYNVQEGKEDDIGNIVHKHEPIPVTNVEPTLGIGAPTDSVF
MIEEAKRPGEYMTAFEDEHGTYIMNSKDLRAIAHVERLTQMGVHSLKIEGRTKSYYYCAR
TAQVYRKAIDDAAAGKPFDTSLLETLEGLAHRGYTEGFLRRHTHDDYQNYEHGYSVSERQ
QFVGDFTGERKGALAAVAVKNKFTKGDSLELMTPQGNMNFTLEHLENGKGEAIDVAPGNG
HTVWLPVPEEVELEFALLMRNFNGESTRNPHSK