Protein Info for MPMX20_03060 in Enterobacter sp. TBS_079

Annotation: Multidrug resistance protein MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 60 to 388 (329 residues), 258.7 bits, see alignment E=3.2e-81 PF25917: BSH_RND" amino acids 84 to 227 (144 residues), 107.3 bits, see alignment E=6.9e-35 PF25973: BSH_CzcB" amino acids 85 to 218 (134 residues), 30.9 bits, see alignment E=5e-11 PF25876: HH_MFP_RND" amino acids 124 to 194 (71 residues), 93.2 bits, see alignment E=2.4e-30 PF25944: Beta-barrel_RND" amino acids 231 to 314 (84 residues), 118.9 bits, see alignment E=2.7e-38 PF25967: RND-MFP_C" amino acids 318 to 379 (62 residues), 97.7 bits, see alignment E=7.2e-32

Best Hits

Swiss-Prot: 86% identical to MDTA_ENT38: Multidrug resistance protein MdtA (mdtA) from Enterobacter sp. (strain 638)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 91% identity to enc:ECL_03401)

MetaCyc: 80% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX20_03060 Multidrug resistance protein MdtA (Enterobacter sp. TBS_079)
MKGSNKSRWAIAAGIIVVALATAWFWHNHSSDTSAGASSPSQRPASGGRHGMRGGALAPV
QAATAVNKAVPRYLSGLGTITAANTVTVRSRVDGQLMALHFQEGQQVKAGDLLAEIDPSQ
FKVTLAQAQGQLAKDKATLANARRDLARYQQLVKTNLVSRQELDTQQSLVSEALGTLKAD
EAAVASAQLQLDWSRITAPIDGRVGLKQVDIGNQISSGDTTGIVVITQTHPVDLVFTLPE
SDIATVVQAQKAGKGLVVEAWDRTNKQKLSEGTLLSLDNQIDTTTGTIKLKARFNNQDDA
LFPNQFVNARMLVATQENAVVIPTAALQMGNEGNFVWVLNSENNVSKHLVKTGIQDSQTV
VISAGLSAGDRVVTDGIDRLTEGAKVEVVEGQQQPAKQGATS