Protein Info for MPMX20_03050 in Enterobacter sp. TBS_079

Annotation: DNA-3-methyladenine glycosylase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF06029: AlkA_N" amino acids 3 to 112 (110 residues), 114.6 bits, see alignment E=3.1e-37 PF00730: HhH-GPD" amino acids 118 to 242 (125 residues), 36 bits, see alignment E=7.5e-13

Best Hits

Swiss-Prot: 69% identical to 3MG2_ECOLI: DNA-3-methyladenine glycosylase 2 (alkA) from Escherichia coli (strain K12)

KEGG orthology group: K01247, DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 89% identity to enc:ECL_03391)

MetaCyc: 69% identical to DNA-3-methyladenine glycosylase 2 (Escherichia coli K-12 substr. MG1655)
DNA-3-methyladenine glycosylase II. [EC: 3.2.2.21]

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>MPMX20_03050 DNA-3-methyladenine glycosylase 2 (Enterobacter sp. TBS_079)
MYTLTWQPPYDWQWMFGFLGARAVAGVETVTDHYYERSFACEGHQGIFRVTPDSQTPTLT
VTLSPGLIPVAQTCLERIGRLFDLDCDPQAIRSTLGDLGAARPGLRLPGAMDAWEQGVRA
ILGQLVSVAMAAKLASRVVALCGEPVEDAPGYLCFPTPHALAAADPLALKALGMPVKRAE
SIVHLAQSVVDGTFPLSPPADIEAGMKALQQRPGIGRWTANYLALRGWQAKDVFLPDDYL
IKQRFAGMTPAQIRRYAQRWHPWRSYALLHIWYTDGWAPSVDGEIAGIKQ