Protein Info for MPMX20_03045 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details PF03741: TerC" amino acids 15 to 203 (189 residues), 167.1 bits, see alignment E=5.4e-53 PF00571: CBS" amino acids 302 to 358 (57 residues), 20.9 bits, see alignment 5.6e-08 amino acids 373 to 422 (50 residues), 26.1 bits, see alignment 1.4e-09 PF03471: CorC_HlyC" amino acids 440 to 516 (77 residues), 72 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 88% identical to YEGH_ECOLI: UPF0053 protein YegH (yegH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_03386)

Predicted SEED Role

"Putative capsular polysaccharide transport protein YegH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>MPMX20_03045 hypothetical protein (Enterobacter sp. TBS_079)
MEWIADPSIWAGLVTLVVIELVLGIDNLVFIAILAEKLPPSQRDRARVTGLLLAMVMRLL
LLASISWLVTLTQPLFSVHGLSFSARDLIMLFGGLFLLFKATVELNERLEGKDSENPTQR
RGAKFWPVVAQIVVLDAVFSLDSVITAVGMVDHLAVMMAAVIIAITLMVMASKALTRFVN
SHPTIVILCLSFLLMIGFSLVADGFGFHIPKGYLYAAIGFSVMIEALNQLAIFNRRRFLS
ANQTLRQRTADTVMRLLSGKKEDAELDAESAAMLADHSDGLIFNPQERLMIERVLNLNQR
TVSSIMTSRHDIEHIDLTAPEEHIRALLDKNQHTRVVVTGGEEEEELLGVVHVIDLLQQQ
LHGEALNLRALVRQPLVFPEGLQLLSALEQFRNARTHFAFVVDEFGSVEGLVTLSDVMET
IAGNLPNEVDEIDARHDIQKNADGSWTANGHMPLEDLVQYVPLPLDEKREYHTIAGLLME
YLQRIPQPGEEVQVGDYLLKTLQVESHRVQKVQLIPLRDEEELDYEV