Protein Info for MPMX20_02851 in Enterobacter sp. TBS_079

Annotation: dTDP-4-amino-4,6-dideoxy-D-glucose transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF01041: DegT_DnrJ_EryC1" amino acids 15 to 364 (350 residues), 330.2 bits, see alignment E=1.9e-102 PF00155: Aminotran_1_2" amino acids 24 to 163 (140 residues), 23.2 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: None (inferred from 70% identity to ctu:CTU_26350)

Predicted SEED Role

"Aminotransferase, DegT/DnrJ/EryC1/StrS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MPMX20_02851 dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (Enterobacter sp. TBS_079)
MSKIYVTSPFLPPLEEFIPYLEQIWQNKTLTNGGPFHQQLEQALAEYLGVKHLSLFANGT
LALLTAFQALRLTGEVITTPYSFVATSHSLLWNGLTPVFADIDPQTYNINPDRIEELITP
NTTAILPVHCYGIPCDIDKIQKIADVYGLRVIYDAAHAFNVRKNDISILNHGDLSVLSFH
ATKVFNTFEGGAIISHDLKTKQRIDYLKNFGFAGETRIVAPGINAKMNEVEAAFGLLQLK
HIDKALDERKAIYQRYCEMLDGLEGLTFVDVPADVSWNHAYFPVLIEPHFGMSRDGVYEL
FKADAILTRRYFYPLISSFAMYRGFPTSAEEHLPVANDIAGKVLCLPIYPGMTLEEQDRV
VNALKRASLVGQAQGNEPTPVTEIAV