Protein Info for MPMX20_02810 in Enterobacter sp. TBS_079

Annotation: putative bacterial non-heme ferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF00210: Ferritin" amino acids 8 to 136 (129 residues), 80.7 bits, see alignment E=5.3e-27

Best Hits

Swiss-Prot: 61% identical to FTNB_ECO57: Bacterial non-heme ferritin-like protein (ftnB) from Escherichia coli O157:H7

KEGG orthology group: K02255, ferritin-like protein 2 (inferred from 84% identity to enc:ECL_01392)

Predicted SEED Role

"Ferritin-like protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>MPMX20_02810 putative bacterial non-heme ferritin (Enterobacter sp. TBS_079)
MTTQTMMQKLNAQLNLEFYASNLHLHISSWCSENSLNGSATFFRSQAQSNVTHMMRVFNF
MKAAGANPTVKALDTIDDNYSSLEELFEKTLEQYEQRCSTLNKLADEARAQHDTKTLKFL
RDMDKAQQQDGMLLKTLADEIHNAQQAGLCPEQTDRHLLDLVTVQHH