Protein Info for MPMX20_02776 in Enterobacter sp. TBS_079

Annotation: tRNA U34 carboxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 322 (316 residues), 562.9 bits, E=4.2e-173
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 7 to 321 (315 residues), 486.7 bits, E=1.1e-150
• PF13489: Methyltransf_23
  • amino acids 111 to 270 (160 residues), 44.2 bits, E=4.3e-15
• PF13847: Methyltransf_31
  • amino acids 123 to 228 (106 residues), 30.4 bits, E=8e-11
• PF13649: Methyltransf_25
  • amino acids 126 to 205 (80 residues), 28.9 bits, E=3.8e-10
• PF08241: Methyltransf_11
  • amino acids 127 to 223 (97 residues), 26.8 bits, E=1.7e-09

Best Hits

Swiss-Prot: 91% identical to CMOB_SALTI: tRNA U34 carboxymethyltransferase (cmoB) from Salmonella typhi

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 96% identity to enc:ECL_01427)

MetaCyc: 90% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (323 amino acids)

>MPMX20_02776 tRNA U34 carboxymethyltransferase (Enterobacter sp. TBS_079)
MIEFSNFYQLIAKNHLSHWLETLPAQIAAWQRDQQHGLLKQWSNAVEFLPELTPHRLDLL
HSVTAQSETPLPPGQINRIETLMRNLMPWRKGPFSLYGVNINTEWRSDWKWDRVLPHLSD
LTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPMQLFLCQFEAVRKLLGNDQRAHLLPLG
IEQLPALKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVSGGELVLETLVVEGDENTVLVPG
DRYAQMRNVYFIPSAPALKNWLEKCGFVDVRIADVCVTSTEEQRRTDWMITESLAEFLDP
ADHSKTVEGYPAPMRAVLIATKP