Protein Info for MPMX20_02764 in Enterobacter sp. TBS_079

Annotation: Zinc import ATP-binding protein ZnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 149 (130 residues), 103 bits, E=2.2e-33

Best Hits

Swiss-Prot: 92% identical to ZNUC_SALPA: Zinc import ATP-binding protein ZnuC (znuC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 97% identity to enc:ECL_01440)

MetaCyc: 92% identical to Zn2+ ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.2.2.20

Protein Sequence (251 amino acids)

>MPMX20_02764 Zinc import ATP-binding protein ZnuC (Enterobacter sp. TBS_079)
MTTLVSLDNISVSFGQRRVLSDVSLDLKPGKILTLLGPNGAGKSTLVRVVLGLVTPDEGV
IRREEKLRIGYVPQKLHLDATLPLTVSRFLRLRPGTHKADILPALKRVQAGHLIDAPLQK
LSGGETQRVLLARALLSSPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELNCAVLMVSHD
LHLVMAKTDEVLCLNHHICCSGTPEVVSMHPEFISMFGPRGAEQLGIYRHHHNHRHDLQG
RIVLRRGNGHS