Protein Info for MPMX20_02696 in Enterobacter sp. TBS_079

Annotation: Murein tetrapeptide carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF02016: Peptidase_S66" amino acids 6 to 126 (121 residues), 72.6 bits, see alignment E=3.3e-24 PF17676: Peptidase_S66C" amino acids 169 to 285 (117 residues), 114.2 bits, see alignment E=5.9e-37

Best Hits

Swiss-Prot: 73% identical to LDCA_ECOLI: Murein tetrapeptide carboxypeptidase (ldcA) from Escherichia coli (strain K12)

KEGG orthology group: K01297, muramoyltetrapeptide carboxypeptidase [EC: 3.4.17.13] (inferred from 89% identity to enc:ECL_01516)

MetaCyc: 73% identical to murein tetrapeptide carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; RXN0-2061 [EC: 3.4.17.13]

Predicted SEED Role

"Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13)" (EC 3.4.17.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MPMX20_02696 Murein tetrapeptide carboxypeptidase (Enterobacter sp. TBS_079)
MSQFHLIAPSGYCINQDAAQRGVQRLLGFGHQVENQTIIPRRQQRFAGTEAQRLNDINSL
VNLKGEDRIVLAVRGGYGASRLLESIDWQGLAQRQQQDPLLICGHSDFTVIQLGLLALHN
VITFSGPMLAGNFGAPALDAFTLEHFWRALRNPTYSITWQGQGPHWACEGQLWGGNLAML
VSLIGTPWLPDIEDGILVLEDINEHPFRVERMLLQLYHAGILERQSAIVLGSFSGAAPND
YDAGYSLETMVDFIRSRLDIPVITGLDFGHEQQTVTLALGAHASLIHDDSGSRLTISGHP
VIKA