Protein Info for MPMX20_02613 in Enterobacter sp. TBS_079

Annotation: Nitrate reductase molybdenum cofactor assembly chaperone NarJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone
  • amino acids 8 to 161 (154 residues), 174.1 bits, E=1e-55
• PF02613: Nitrate_red_del
  • amino acids 39 to 158 (120 residues), 55.4 bits, E=3.4e-19

Best Hits

Swiss-Prot: 83% identical to NARJ_ECOLI: Nitrate reductase molybdenum cofactor assembly chaperone NarJ (narJ) from Escherichia coli (strain K12)

KEGG orthology group: K00373, nitrate reductase 1, delta subunit [EC: 1.7.99.4] (inferred from 96% identity to enc:ECL_01624)

Predicted SEED Role

"Respiratory nitrate reductase delta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Protein Sequence (236 amino acids)

>MPMX20_02613 Nitrate reductase molybdenum cofactor assembly chaperone NarJ (Enterobacter sp. TBS_079)
MIELVIVSRLLEYPDAALAQHQQELFDALASSENLEKEDAQTLAVFLRDLLARDLLDAQA
DYSQLFDRGRATSLLLFEHVHGESRDRGQAMVDLMGQYEQHGLQLDSRELPDHLPLYLEY
LAQLPKEEALGGLQDIAPILALLGARLQQRESRYAVLFDLLVKLANASVDSEKVAEKIAD
EARDDTPQALDAVWEEEQVKFMADQNCGESEISAHQRRFAGAVAPQYLNISNGGQQ