Protein Info for MPMX20_02600 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 136 (131 residues), 51.9 bits, see alignment E=5.2e-18 amino acids 150 to 277 (128 residues), 63.8 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 89% identity to enc:ECL_01626)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MPMX20_02600 hypothetical protein (Enterobacter sp. TBS_079)
MGDVQKGVWQMSLAMLISGSIGAFVLLSGLPVTEVVFWRCLIGAMALFIFIRISRKPFSP
LTRVTLLLAILGGVALVVNWLLLFAAYERISIGLSTVVYNTQPFMLVLMGMFLGERVSLV
KWGWLVLAFGGVVILLSSELNGAQGEGWLAGIGLAMGAAFFNALTAIIARRLKSVAPQHI
AFIQVLTGVVMLLPFAHQPALSADFPWQILLTLGVVHTGIMYQLLYSAIQKLPTPVTGSL
SFIYPVVAIIVDNVVFGHSLNITQLAGGALILFAAAGNNLGWGEKKPRECGVGIKSAH