Protein Info for MPMX20_02585 in Enterobacter sp. TBS_079

Annotation: Oligopeptide transport system permease protein OppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 76 (53 residues), 58.5 bits, see alignment 4.9e-20 PF00528: BPD_transp_1" amino acids 119 to 300 (182 residues), 95.1 bits, see alignment E=4.6e-31

Best Hits

Swiss-Prot: 96% identical to OPPC_SALTY: Oligopeptide transport system permease protein OppC (oppC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to enc:ECL_01639)

MetaCyc: 95% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>MPMX20_02585 Oligopeptide transport system permease protein OppC (Enterobacter sp. TBS_079)
MMLSKKNSEALENFSEKLEVEGRSLWQDARRRFMHNRAAVASLVVLVLIALFVTLAPILS
QFTYFDTDWGMMSSAPDMTSGHYFGTDSSGRDLLVRVAIGGRISLMVGIAAALVAVIVGT
LYGSLSGYLGGKVDSVMMRMLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMA
RIVRGQTLSLKRKEFIEAAQVGGVSTGNIVVRHIVPNVLGVVVVYASLLVPSMILFESFL
SFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLYPAGFLVVTLFCFNFIGDGLRDALDPK
DR