Protein Info for MPMX20_02561 in Enterobacter sp. TBS_079

Annotation: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08659: KR" amino acids 5 to 159 (155 residues), 54.7 bits, see alignment E=2.5e-18 PF00106: adh_short" amino acids 6 to 192 (187 residues), 152.6 bits, see alignment E=1.9e-48 PF01370: Epimerase" amino acids 6 to 139 (134 residues), 25.4 bits, see alignment E=1.8e-09 PF13561: adh_short_C2" amino acids 10 to 192 (183 residues), 97.6 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 82% identity to srs:SerAS12_3187)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MPMX20_02561 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX (Enterobacter sp. TBS_079)
MTKTSVLITGASTGIGAVYAQRFASRGHDLVLVARDKTKLDALAERLRQEKGVSVDVLPA
DLTQAADLATVEARLREDEKIGVLINNAGMAQSGNFTGQTPEAIERLIALNVTALTRLAS
AAAPRFVKTGEGAIVNISSVVGLAPEFAMTVYGATKAFVLFLSQGLHLELSSAGVYVQAV
LPAGTYTEIWERAGIDISKAPEMMEVGQLVDAALAGFDRRELVTIPPLQNAAHWDDLEKA
RQALLADINQAKAAERYTV