Protein Info for MPMX20_02507 in Enterobacter sp. TBS_079

Annotation: Ribosomal large subunit pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF01479: S4" amino acids 4 to 43 (40 residues), 41.5 bits, see alignment 8.8e-15 PF00849: PseudoU_synth_2" amino acids 69 to 200 (132 residues), 73 bits, see alignment E=3.2e-24 TIGR00093: pseudouridine synthase" amino acids 73 to 233 (161 residues), 211.4 bits, see alignment E=3.2e-67

Best Hits

Swiss-Prot: 94% identical to RLUB_SALTY: Ribosomal large subunit pseudouridine synthase B (rluB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06178, ribosomal large subunit pseudouridine synthase B [EC: 5.4.99.12] (inferred from 99% identity to enc:ECL_01733)

MetaCyc: 94% identical to 23S rRNA pseudouridine2605 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11836 [EC: 5.4.99.22]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MPMX20_02507 Ribosomal large subunit pseudouridine synthase B (Enterobacter sp. TBS_079)
MSEKLQKVLARAGHGSRREIEAIIEAGRVSVDGKIATLGDRVEIVPGLKIRIDGHLISVK
ESAEQICRVLAYYKPEGELCTRNDPEGRPTVFDRLPKLRGARWIAVGRLDVNTCGLLLFT
TDGELANRLMHPSREVEREYAVRVFGQVDENKLRDLSRGVQLEDGPAAFKTIKFTGGEGI
NQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDILLPKGLPRGGYTELDLTQTNYL
RELVGLTPETTSKVAVEKDRRRMKANQIRRAVKRHSQVSSNRRSGSRNNNG