Protein Info for MPMX20_02462 in Enterobacter sp. TBS_079

Annotation: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 9 to 128 (120 residues), 115 bits, see alignment E=6.9e-37 PF03447: NAD_binding_3" amino acids 15 to 127 (113 residues), 26.1 bits, see alignment E=2.5e-09 PF22725: GFO_IDH_MocA_C3" amino acids 138 to 272 (135 residues), 56.3 bits, see alignment E=6.9e-19 PF02894: GFO_IDH_MocA_C" amino acids 141 to 350 (210 residues), 104.9 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 78% identical to YCJS_ECOLI: Uncharacterized oxidoreductase YcjS (ycjS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_01786)

MetaCyc: 78% identical to D-glucoside 3-dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Putative oxidoreductase YcjS (EC 1.-.-.-), NADH-binding" in subsystem Maltose and Maltodextrin Utilization (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MPMX20_02462 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase (Enterobacter sp. TBS_079)
MSASTPSLLRVAIIGAGQVADKVHASYYATRSDVQMLAVMDSGLEQAQAFAERHAIPSVW
QNASEMLQAVKPDVVSVCSPNRFHFEHVMAALEAGCHVMCEKPPAMTPQQADQMRMAARK
AGKVLAYDFHHRFALDTQLLRDAVTNGALGEIYFTSAQALRRCGVPGWGVFTNKSLQGGG
PLIDIGIHMLDAAMYVLGFPAVKRVTAHSFQKLGNRKNSGQFGEWDPARFTVEDALFGTI
EFCNGGVLRLDTSFALNIREQSIMNVSFCGEKAGATLFPAHIYHDEAGVLQTLMQRDEAD
DQRHLRSMEAFIRHVLGEPVMIADAEQGLVIQQLVAALYESADTGESVTLC