Protein Info for MPMX20_02408 in Enterobacter sp. TBS_079

Annotation: Fe(3+) dicitrate transport protein FecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07715: Plug" amino acids 45 to 155 (111 residues), 80 bits, see alignment E=2.7e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 46 to 703 (658 residues), 234.4 bits, see alignment E=1.5e-73 PF00593: TonB_dep_Rec_b-barrel" amino acids 236 to 666 (431 residues), 201.7 bits, see alignment E=6e-63 PF14905: OMP_b-brl_3" amino acids 404 to 582 (179 residues), 35.8 bits, see alignment E=7.2e-13

Best Hits

Swiss-Prot: 79% identical to YNCD_ECOLI: Probable TonB-dependent receptor YncD (yncD) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 95% identity to enc:ECL_01867)

MetaCyc: 79% identical to pyrroloquinoline quinone outer membrane transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-629

Predicted SEED Role

"Probable tonB-dependent receptor yncD precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (704 amino acids)

>MPMX20_02408 Fe(3+) dicitrate transport protein FecA (Enterobacter sp. TBS_079)
MKIISARKATLPLLLVPVISAPLTAMSADEQTMIVSATPQTVSELDTPAAVSVVNGEDMR
HAAPRINLSESLGSVPGLQIQNRQNYAQDLQLSMRGFGARSTFGVRGIRMYVDGIPATMP
DGQGQTSNIDLSSVDSVEVLRGPFSALYGNASGGVINMTTQTGQQPPTIEASSYYGSYGT
WRYGMKATGAMGDGTHAGDVDYTVSTTRFTTKGYRDHSGARKNLANAKLGVRIDDVSKLT
LIFNSVDMKANDPGGLSAQEWHDNPRQSPRGDQYNTRKTIKQTQAGLRYDRQLSTQDDLS
VMMYAGEREMTQYQSIPYQPQLRPSHSGGVIDMQRHYQGIDTRWTHRGELLVPVTFTTGL
NYENMSEDRRGYENFVMNNGVPEYGVKGDKRRNERNLMWNVDPYLQTSWQLTQKLSVDAG
VRYSSVWFDSNDHYLTPGNGDDSGDASYHKWLPAGSVKYAVTDAWNLYAAAGRGFETPTI
NELSYRADNQGGLNIGLKPSTNNTYEVGSKTRIGNGLLTAALFRTDTDDEIVVDASAGGR
TSYKNAGKTRRQGVEVSLDQQFAENWKLKMAWTYLDATYRTNVCSTGDCNGNRMPGIARN
MGYASFGWQPEEGWYAGSDVRYMSDIMADDENTAKAPSYTVVGLNTGYKFNYGNWGMDVF
GRVDNLFDKEYVGSVIVNESNGRYYEPAPGRNYGVGLSVSYRFE