Protein Info for MPMX20_02405 in Enterobacter sp. TBS_079

Annotation: Aerotaxis receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 175 to 194 (20 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 26 to 128 (103 residues), 44.6 bits, see alignment E=7.2e-16 PF00989: PAS" amino acids 27 to 117 (91 residues), 26.2 bits, see alignment E=1.4e-09 PF13426: PAS_9" amino acids 29 to 118 (90 residues), 34 bits, see alignment E=6.2e-12 PF08447: PAS_3" amino acids 37 to 119 (83 residues), 48.7 bits, see alignment E=1.5e-16 PF00015: MCPsignal" amino acids 329 to 482 (154 residues), 152.4 bits, see alignment E=2.2e-48

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 81% identity to ent:Ent638_2094)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>MPMX20_02405 Aerotaxis receptor (Enterobacter sp. TBS_079)
MTMGLLMRNNTPVTQNEYLLNEGSTLMSTTNTHSHITYANSAFIDASGYKEESLLGEPHN
LIRHPDMPAEAFGDMWFTLQQGETWTGLVKNRRQNGDHYWVRANVTPVYQNETLTGYISV
RNIPSREEIAVSEKRYEKVRNNELKHHRFYKGLFVRHGLFSFTSLFKRLSTSKRIHLGIA
ITALLACLQLFIFADRIVETVGLALLFIALAVYLHAQIAKPVKSIVQQMQRVVSGRKADY
YHFDRVDEIGLMMRMVNQSGLNLHSLVDDVGAQISGISTISQQVAKEGMALQTRTEETAD
FLQQTASAVEEIASAVQQTAETAKDAILMADRTRTSAHRGEAMMKETIGMMQSVSQDNSQ
IVDIISVIDRIAFQTNILALNAAVEAARAGDAGRGFAVVAAEVRNLAQHSATAAKEIKTL
IEKNVSSVNAGVEKVEQTESQLTVMIGNVMEMSSLIKEIGHATQEQTQALTLINASISRI
GTMTQNNTGMVDNVTDAAHHLTQRTTRLQQAIAVFGG