Protein Info for MPMX20_02376 in Enterobacter sp. TBS_079

Annotation: Formate dehydrogenase, nitrate-inducible, cytochrome b556(Fdn) subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 6 to 205 (200 residues), 227.9 bits, see alignment E=5.9e-72 PF01292: Ni_hydr_CYTB" amino acids 11 to 185 (175 residues), 82.4 bits, see alignment E=1.8e-27

Best Hits

Swiss-Prot: 86% identical to FDNI_SHIFL: Formate dehydrogenase, nitrate-inducible, cytochrome b556(Fdn) subunit (fdnI) from Shigella flexneri

KEGG orthology group: K08350, formate dehydrogenase-N, gamma subunit [EC: 1.2.1.2] (inferred from 93% identity to esc:Entcl_2347)

MetaCyc: 86% identical to formate dehydrogenase N subunit gamma (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase N gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>MPMX20_02376 Formate dehydrogenase, nitrate-inducible, cytochrome b556(Fdn) subunit (Enterobacter sp. TBS_079)
MSKSWIVRTKFVDRACHWTVVICFFLVAVSGISFFFPTLQWLTETFGTPQMGRILHPFFG
VLIFVVLMFMFARFVHHNIPDKHDIPWLKGIIEVLKGNEHKVAKVGKYNAGQKMMFWTIM
SMIFVLLVTGVIIWRPYFAHYFPIQVIRYALLIHATSAIILIHAILIHMYMAFWVKGSIK
GMIEGKVSRRWAQKHHPRWYRDVERLEAKQESTKGMP