Protein Info for MPMX20_02375 in Enterobacter sp. TBS_079

Annotation: Polyphosphate:ADP phosphotransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF03976: PPK2" amino acids 20 to 242 (223 residues), 310.8 bits, see alignment E=3e-97 TIGR03707: polyphosphate kinase 2" amino acids 20 to 244 (225 residues), 352 bits, see alignment E=8.1e-110

Best Hits

Swiss-Prot: 58% identical to PK21C_RHIME: Polyphosphate:ADP phosphotransferase 3 (SMa0670) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_01906)

Predicted SEED Role

"FIG00627064: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>MPMX20_02375 Polyphosphate:ADP phosphotransferase 3 (Enterobacter sp. TBS_079)
MGSKKKTSVAVDVIKHEPLKTKEYEKELRRLHVELVKLQQWVVAKGLKVCIVFEGRDGAG
KGGTIKAITERVSPRVFRVVALPAPTEKEKTQLYFQRYVPHLPAAGEIVIFDRSWYNRAG
VERVMGFCTPEQVEKFLDGTPVMEKAMVDAGIILLKYWLEVTPKEQERRLRDRINDGRKT
WKLSPMDIKSFNLWDEYTVARDAMFAATDTAWAPWFVARSEDKKRVRLNIISHLLAQIPY
KTIHIEAVSLPKRKIGKVKPTQYPFRYVEERF