Protein Info for MPMX20_02349 in Enterobacter sp. TBS_079

Annotation: Negative regulator of SacY activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 108 to 132 (25 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 280 to 308 (29 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details TIGR01996: PTS system, sucrose-specific IIBC component" amino acids 3 to 448 (446 residues), 649.1 bits, see alignment E=5.3e-199 PF00367: PTS_EIIB" amino acids 9 to 41 (33 residues), 48.6 bits, see alignment (E = 4.3e-17) TIGR00826: PTS system, glucose-like IIB component" amino acids 28 to 111 (84 residues), 77.1 bits, see alignment E=1.5e-25 PF02378: PTS_EIIC" amino acids 110 to 395 (286 residues), 194.2 bits, see alignment E=3.2e-61 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 153 to 437 (285 residues), 311.4 bits, see alignment E=8.9e-97

Best Hits

Swiss-Prot: 94% identical to PTSBC_SALTM: PTS system sucrose-specific EIIBC component (scrA) from Salmonella typhimurium

KEGG orthology group: K02809, PTS system, sucrose-specific IIB component [EC: 2.7.1.69] K02810, PTS system, sucrose-specific IIC component (inferred from 98% identity to enc:ECL_01931)

MetaCyc: 93% identical to Enzyme IIscr (Klebsiella pneumoniae)
SUCROSEPHOSPHO-RXN [EC: 2.7.1.211]

Predicted SEED Role

"PTS system, sucrose-specific IIB component (EC 2.7.1.69) / PTS system, sucrose-specific IIC component (EC 2.7.1.69)" in subsystem Sucrose utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.211 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>MPMX20_02349 Negative regulator of SacY activity (Enterobacter sp. TBS_079)
MDFDNIARALIPLLGGKENIASAAHCATRLRLVLVDDTLADQQAIGKVDGVKGCFRNAGQ
MQVIFGTGVVNKVYAAFIQAAGISESSKSEAADLAARKLNPFQRIARLLSNIFVPIIPAI
VASGLLMGLLGMVKTYGWVNADNALYIMLDMCSSAAFIILPILIGFTAAREFGGNPYLGA
TLGGILTHPALTNAWGVASGFHTMNFFGLEIAMIGYQGTVFPVLLAVWFMSIVEKNLRRI
IPDALDLILTPFLTVILSGFIALLIIGPAGRALGDGISFVLSTLIAHAGWLAGLLFGGLY
SVIVITGIHHSFHAIEAGLLGNPSIGVNFLLPIWAMANVAQGGACLAVWFKTKDAKIKAI
TLPSAFSAMLGITEAAIFGINLRFVKPFIAALIGGAAGGAWVVSVHVYMTAVGLTAIPGM
AIVQASSLLNYIIGMVIAFGVAFTVSLLLKYKTDSE