Protein Info for MPMX20_02347 in Enterobacter sp. TBS_079

Annotation: Catabolite repressor/activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00356: LacI" amino acids 8 to 56 (49 residues), 62.3 bits, see alignment 5.8e-21 TIGR02417: D-fructose-responsive transcription factor" amino acids 8 to 333 (326 residues), 466.2 bits, see alignment E=2.9e-144 PF00532: Peripla_BP_1" amino acids 68 to 294 (227 residues), 38.2 bits, see alignment E=2.4e-13 PF13407: Peripla_BP_4" amino acids 70 to 271 (202 residues), 45 bits, see alignment E=2.1e-15 PF13377: Peripla_BP_3" amino acids 184 to 332 (149 residues), 45.7 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 83% identical to SCRR_KLEPN: Sucrose operon repressor (scrR) from Klebsiella pneumoniae

KEGG orthology group: K03484, LacI family transcriptional regulator, sucrose operon repressor (inferred from 97% identity to enc:ECL_01933)

Predicted SEED Role

"Sucrose operon repressor ScrR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX20_02347 Catabolite repressor/activator (Enterobacter sp. TBS_079)
MRKTKRVTIKDIAELAGVSKATASLVLNGRSKELRVAEETRERVLAIAKEHHYQPSIHAR
SLRDNRSHTIGLVVPEITNYGFAVFSHELETLCREAGVQLLISCSDENPGQETVVVNNMV
ARQVDGLIVASSMLNDADYQKLSEQLPVVLFDRHMNDSTLPLVITDSITPTAELVADIAR
QHPDEIYFLGGQPRLSPTRDRLEGFKQGLQEANVALRPEWIIHGNYHPSSGYEMFAELCA
RLGRPPKALFTAACGLLEGVLRYMGQHNLMQSDIRLASFDDHYLYDSLTIPVDTIRQDNR
QLAWHCFDLIGKLIDGETPQPLQRKLDATLQRRYKAKA