Protein Info for MPMX20_02331 in Enterobacter sp. TBS_079

Annotation: Lipoprotein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01533: 5'-nucleotidase, lipoprotein e(P4) family" amino acids 20 to 239 (220 residues), 229.1 bits, see alignment E=2.9e-72 PF03767: Acid_phosphat_B" amino acids 24 to 233 (210 residues), 118.2 bits, see alignment E=2.1e-38

Best Hits

KEGG orthology group: None (inferred from 87% identity to enc:ECL_01948)

Predicted SEED Role

"Acid phosphatase (EC 3.1.3.2)" (EC 3.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.2

Use Curated BLAST to search for 3.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>MPMX20_02331 Lipoprotein E (Enterobacter sp. TBS_079)
MAKALLLALPVISATATAADHEICEPKAYEMALRYQQKSAEIMALQLQTYRFATERFNEK
IKGLTAPENYAVVMDLDETVLDNTPLLARDAEQCHDYTKWDTWSDWEKQGKPGLIPGAKA
FLDRVNQSKVRIYYVSDRMQENKADTLNTLKSLGLPQVSEDSVLLDTVSKEARRQSILKK
QQIIMLFGDSLPDFAAQFKNKKPSEAQRELVEASADRFGSDWIVLPNAAYGSWSKATLES
WKAPLKQ