Protein Info for MPMX20_02243 in Enterobacter sp. TBS_079

Annotation: HTH-type transcriptional regulator SutR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF13560: HTH_31" amino acids 7 to 59 (53 residues), 32 bits, see alignment E=2.5e-11 PF13413: HTH_25" amino acids 10 to 44 (35 residues), 25 bits, see alignment 2.7e-09 PF01381: HTH_3" amino acids 11 to 63 (53 residues), 55.3 bits, see alignment E=1.1e-18 PF07883: Cupin_2" amino acids 102 to 169 (68 residues), 44.2 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 67% identical to SUTR_ECOLI: HTH-type transcriptional regulator SutR (sutR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_02024)

Predicted SEED Role

"Transcriptional regulator yidN, Cro/CI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>MPMX20_02243 HTH-type transcriptional regulator SutR (Enterobacter sp. TBS_079)
MDITQHLAYTLKTERQARGWSLARLAEETGVSKAMLGQIERNESSPTVSTLWKIATGLNI
PFSAFITPAADRQAVFDPEQQAMVVKPLFPWDETLKFDHFSITLAAGALSESTPHEAGVI
EHVVVISGELEMNIDGEWQTITADSGVRFAGDKPHAYRNSSDRPVHFHSLIHYPR