Protein Info for MPMX20_02230 in Enterobacter sp. TBS_079

Annotation: Methionine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF00155: Aminotran_1_2" amino acids 33 to 383 (351 residues), 196.9 bits, see alignment E=1.2e-61 PF01053: Cys_Met_Meta_PP" amino acids 62 to 206 (145 residues), 33 bits, see alignment E=5.2e-12 PF00266: Aminotran_5" amino acids 75 to 204 (130 residues), 29 bits, see alignment E=1.1e-10 PF01041: DegT_DnrJ_EryC1" amino acids 92 to 203 (112 residues), 36.8 bits, see alignment E=5.5e-13

Best Hits

Swiss-Prot: 51% identical to YBDL_ECOLI: Methionine aminotransferase (ybdL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_02037)

MetaCyc: 51% identical to methionine transaminase (Escherichia coli K-12 substr. MG1655)
R15-RXN [EC: 2.6.1.88]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>MPMX20_02230 Methionine aminotransferase (Enterobacter sp. TBS_079)
MTLHTPVHTRSKLPDVGTTIFTVIGQLSARHNAINLSQGAPNFSCDPKLVAGVTRAMEAG
HNQYAAMTGLQPLKERIADKIATLYGTHYDPASEVLVTASASEGLYSAISGLVHPGDEVI
YFEPSFDSYAPIVRLQGATPVAIKLTVPDFAVNWDEVRATITPRTRMIIINTPHNPSGQV
FSAEDLQQLVAVTRNTDIIILSDEVYEHVVFDGEPHHGMATHPQLAERSVIISSFGKTYH
VTGWRVGYCVAPAVLMDEICKVHQFLMFSADTPMQHAFAEHMIDPQTWLSLAAFYQRKRD
LLQSLLEASPFRLLPSAGSFFLLADYSQFSDERDSELVKRLIVEYGVATIPLSAFYADGT
DNKLIRLSFAKDEATLRAGAQALCRVKPR