Protein Info for MPMX20_02201 in Enterobacter sp. TBS_079

Annotation: Toxin RTX-I translocation ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 transmembrane" amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 434 to 443 (10 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 32 to 724 (693 residues), 829 bits, see alignment E=1.6e-253 PF00664: ABC_membrane" amino acids 186 to 445 (260 residues), 108.2 bits, see alignment E=9.5e-35 PF00005: ABC_tran" amino acids 517 to 664 (148 residues), 108.3 bits, see alignment E=7.2e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 96% identity to enc:ECL_02074)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (750 amino acids)

>MPMX20_02201 Toxin RTX-I translocation ATP-binding protein (Enterobacter sp. TBS_079)
MPRGAILAAFCVAITKSDKRFHNIMKTHPQYEPWLQGMLIIAKHYRLDFSAEHVRVTINH
ESQSPRQLVLEEMARQLGLGMRMVAADAVSLDPWRLPLLAEFTGGQIAVINRMDSEGNVS
LQFSGDGGLETTLTRDALCSRLTGLLVLRPLESTPDARVDDYIKPYEKNWFWQLALKDWR
RYSDIMLVALVANVLALSGMVFSMQVYDRVVPSQSEATLWVLFGGVMIAIVFEFIMRMLR
VHISDVVGKRADLRISERVFAHALRIKNGARSKSTGSFIAQIRELESVRELITSTTIAAI
SDLPFFLLFVFILWMIGGPLVLVVLLAVPLLLIPGLLVQRPLGKLSSEGMRESAIRNATL
VEAVQGIEDIKLMRAEQRFQNQWNNTNDVAANVGMKQRWLTGLLLTWTQEVQSIVYAVVL
LVGCYLVISGDMTTGALVGTSILASRTIAPLSQISGVLSRWQSAKVARKGLDDLMQRPID
DPQQGKKVHKAHLRGDYALEEVGFWYDDEEKLTVLNISKLQIRAGERVAVLGRNGSGKST
LLQLLAGMQEPQQGSILLDNIALNHLDPADVRRDMQLLSQQARLFFGSVRDNILMGNPLA
TDDEIHQALVNSGALEFVRKQKMGLNYIINEGGAGLSGGQRQALLLARALITSPNILLLD
EPTAWLDEMSEKQFIQHLKPWLGKRRTLVVATHRLPILELVDRIIVLENGKVIMDGPRDA
ILRQHGMAPQKASQRTVTMKPTPVVEEGVA