Protein Info for MPMX20_02199 in Enterobacter sp. TBS_079

Annotation: Outer membrane efflux protein BepC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01844: type I secretion outer membrane protein, TolC family
  • amino acids 40 to 438 (399 residues), 313.5 bits, E=1.2e-97
• PF02321: OEP
  • amino acids 49 to 227 (179 residues), 82.9 bits, E=1.3e-27
  • amino acids 256 to 421 (166 residues), 62 bits, E=3.4e-21

Best Hits

KEGG orthology group: None (inferred from 88% identity to enc:ECL_02077)

Predicted SEED Role

"Agglutination protein"

Protein Sequence (445 amino acids)

>MPMX20_02199 Outer membrane efflux protein BepC (Enterobacter sp. TBS_079)
MTIMRNNMLLRFPVALALISLAFNTASANSRQVGIAPIAATTLKESILFAIDRDPSISQQ
AAQLGIGQAQIDEARSGWMPQISLNGSTGHSQTTDSSGSLRNSAAWGLSLTQLVYDFGKT
NNSIDQSTAQRDSYRYQLMSTLSAVAEKTALSYVEVKRYSDLLQAAKEDVQALKNVEQLA
KLRADAGVSSTSDELQTRTRIAGMQATVEQYNAALNSARARLAVLTGMEAERYSPVPAKL
AVEQDSLNRIDYSAIPAVMAAQNMERSAQYGVATAKSQHWPTLSLKGGRTRYESDNRSYW
DDQIQLNIDAPLYQGGAVSARVRQAEGARAMASSQVDQARFDVLQKASVAQADWTGAQGR
MQAGKLQLESALRARDVYRNEYTLSKRSINDLLSVEQDVWQATSAKIMAEYDGWSSAINY
ASAVDNLMPLIGIEKNAAAKLPDLS