Protein Info for MPMX20_02192 in Enterobacter sp. TBS_079

Annotation: Colistin resistance protein EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF25917: BSH_RND" amino acids 64 to 256 (193 residues), 53.3 bits, see alignment E=6.2e-18 PF25954: Beta-barrel_RND_2" amino acids 262 to 303 (42 residues), 30.5 bits, see alignment 1e-10 PF25963: Beta-barrel_AAEA" amino acids 262 to 353 (92 residues), 31.1 bits, see alignment E=6.1e-11 PF25990: Beta-barrel_YknX" amino acids 263 to 353 (91 residues), 32.2 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_02087)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>MPMX20_02192 Colistin resistance protein EmrA (Enterobacter sp. TBS_079)
MSQQDAAKEQANTRKNVRIVSVFTAAAIGIVGVLVILYAWQLPPFTRHSQFTDNAYVRGQ
TTFISPQVNGYITEVKVQDFDRVKKGELLLQIDDRIYRQRVHQAEAQLAMKIAALNNNLQ
QRKSAEAVIAKNEAALKNARAQSLKSQADLKRVKDLTADGSLSIRERDAALASAAQGSAD
IDQAKATLEMSRQDLQTVIVNRGALEADVENAKAALELAQIDLQNTRIVAPRDGQLGQIA
VRLGAYVTAGTHLTTLVPPQHWVIANIKETQLAELRVGQPVKFTVDALNDKAYQGRVESI
SPATGIEFSAITPDNATGNFVKIAQRIPVRIEVLGDQEAYQLLRPGMSVQVTIDTREAKQ