Protein Info for MPMX20_02181 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 5 to 139 (135 residues), 112.1 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K09936, hypothetical protein (inferred from 88% identity to enc:ECL_02098)

Predicted SEED Role

"FIG123062: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MPMX20_02181 hypothetical protein (Enterobacter sp. TBS_079)
MTLIMIMLAVCGGATLSIQAAINGQLGSSVGVFKSAFLTFSVGALVTALLIFFFEPKQAV
TLMDVPKWQLLGALFGVPYIVIMVLAVQRIGTAVATVAVIFGQLTMSMLIDSFGWLGNAV
IPFSLSRLGAIVCLAIALIFIYLSSKTPAEPAPGSE