Protein Info for MPMX20_02093 in Enterobacter sp. TBS_079

Annotation: Starvation-sensing protein RspB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF08240: ADH_N" amino acids 24 to 133 (110 residues), 102.7 bits, see alignment E=1.9e-33 PF16912: Glu_dehyd_C" amino acids 139 to 324 (186 residues), 38.2 bits, see alignment E=1.7e-13 PF00107: ADH_zinc_N" amino acids 171 to 297 (127 residues), 69.5 bits, see alignment E=4.1e-23

Best Hits

Swiss-Prot: 76% identical to RSPB_ECOLI: Starvation-sensing protein RspB (rspB) from Escherichia coli (strain K12)

KEGG orthology group: K08322, starvation sensing protein RspB [EC: 1.1.1.-] (inferred from 90% identity to enc:ECL_02182)

Predicted SEED Role

"Starvation sensing protein RspB"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX20_02093 Starvation-sensing protein RspB (Enterobacter sp. TBS_079)
MKSVVIQQPNALVIEDRPLPEPAAGEVRVNVKLAGICGSDSHIYRGHNPFARYPRVIGHE
FFGEIDAVGEGVDPARVGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AVVPAKNAWVVPDAIPDKHAVMIEPFTIAANVTGHAQPTGQDIALIYGAGPMGLVTVQAL
KGVYKVKQVIVVDRINERLAMAQRSGADWVFNNAELSLQAALEEKGIKPTLIIDAACHPT
ILQEAITIASPAARIVLMGFSSDPSQIVQQGITGKELAIFSSRLNANKFPVVIDWLEKGL
IDPDKLITHTFDYHHVTDAIERFEKDQRQCCKVLLTFGQ