Protein Info for MPMX20_02065 in Enterobacter sp. TBS_079

Annotation: Voltage-gated ClC-type chloride channel ClcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 34 (15 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 182 to 182 (1 residues), see Phobius details amino acids 187 to 214 (28 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 363 to 388 (26 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 83 to 414 (332 residues), 259.6 bits, see alignment E=2.5e-81

Best Hits

Swiss-Prot: 79% identical to CLCB_CITK8: Voltage-gated ClC-type chloride channel ClcB (clcB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 92% identity to enc:ECL_02218)

MetaCyc: 76% identical to putative chloride:H+ antiporter ClcB (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"FIG00509904: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>MPMX20_02065 Voltage-gated ClC-type chloride channel ClcB (Enterobacter sp. TBS_079)
MQRLHAYPDIRAMFRRLLIATLTGILAALAVAVFRHSMYLLEWLFLSNNSGSLVNAAAAL
SPWRRALTPALGGLAAGLLLWGWQRLTAQRPHAPTDYMEALETGDGQFDYGSSLVKSLAS
LLVVSSGSAIGREGAMILLAALAASFFAQRFTPKSEWKLWIACGAAAGMASAYHAPLAGS
LFIAEILFGTLMLASLGPVVIAAVVALLTTRLLAPGAGTLYDVHLSGLLSAADYGLLVVT
GLLAGLCGPLLMWLMAFCHSLFLRLRLSPPWQLALGGAIVGLLSLLTPDVWGNGYSVVQA
FLLAPPLLSVIAGVFICKLLAVLASSGSGAPGGVFTPTLFVGMATGMLFAQLFGLWFPGS
ETVILLGLAGMATLLAATTHAPIMSVLMVCEMTGQYFLLPGLLIACVIASVLSRTLRHDS
IYGQHPTEGREIDVLR