Protein Info for MPMX20_02011 in Enterobacter sp. TBS_079

Annotation: Ion-translocating oxidoreductase complex subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details TIGR01943: electron transport complex, RnfABCDGE type, A subunit" amino acids 3 to 191 (189 residues), 307 bits, see alignment E=3.9e-96 PF02508: Rnf-Nqr" amino acids 5 to 190 (186 residues), 203.9 bits, see alignment E=1e-64

Best Hits

Swiss-Prot: 96% identical to RNFA_CITK8: Ion-translocating oxidoreductase complex subunit A (rnfA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 95% identity to eco:b1627)

MetaCyc: 55% identical to Rnf complex RnfA subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>MPMX20_02011 Ion-translocating oxidoreductase complex subunit A (Enterobacter sp. TBS_079)
MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTMASICAWLID
NWILIPLDLIYLRTLSFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA
LLNINLGHNFMQSALYGFSAAVGFSLVMVLFASIRERLAAADIPAPFRGNAIALVTAGLM
SLAFMGFSGLVKL