Protein Info for MPMX20_02010 in Enterobacter sp. TBS_079

Annotation: Ion-translocating oxidoreductase complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 1 to 191 (191 residues), 282 bits, see alignment E=9.4e-89 PF04060: FeS" amino acids 44 to 76 (33 residues), 45.6 bits, see alignment 2e-15 PF14697: Fer4_21" amino acids 110 to 164 (55 residues), 66.9 bits, see alignment E=6.2e-22 PF12837: Fer4_6" amino acids 110 to 132 (23 residues), 27.4 bits, see alignment (E = 1.1e-09) PF13237: Fer4_10" amino acids 111 to 158 (48 residues), 28.6 bits, see alignment E=5.3e-10 PF00037: Fer4" amino acids 111 to 132 (22 residues), 29.1 bits, see alignment (E = 2.8e-10) amino acids 141 to 163 (23 residues), 23.1 bits, see alignment (E = 2.2e-08) PF13187: Fer4_9" amino acids 116 to 162 (47 residues), 27.8 bits, see alignment E=9.6e-10

Best Hits

Swiss-Prot: 87% identical to RNFB_KLEP3: Ion-translocating oxidoreductase complex subunit B (rnfB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 95% identity to enc:ECL_02307)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>MPMX20_02010 Ion-translocating oxidoreductase complex subunit B (Enterobacter sp. TBS_079)
MSTVWIAIASISVLGLVFGLILGYASRRFAVEDDPVVEKIDELLPQSQCGQCGYPGCRPY
AEAVGVQGEKINRCAPGGEAVMLKIAALLNVDPQPVDGDEDVQEPVRALAVIDEANCIGC
TKCIQACPVDAIVGATRAMHTVVADLCTGCNLCVAPCPTQCITLRPVEPTTESWKWDLQT
IPVRIIPVEQHA