Protein Info for MPMX20_02004 in Enterobacter sp. TBS_079

Annotation: Dipeptide and tripeptide permease A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 24 to 49 (26 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 456 to 478 (23 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 18 to 486 (469 residues), 462.2 bits, see alignment E=1.2e-142 PF07690: MFS_1" amino acids 36 to 435 (400 residues), 68.1 bits, see alignment E=6.8e-23 PF00854: PTR2" amino acids 90 to 448 (359 residues), 318.9 bits, see alignment E=4.8e-99

Best Hits

Swiss-Prot: 94% identical to DTPA_ENT38: Dipeptide and tripeptide permease A (dtpA) from Enterobacter sp. (strain 638)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 96% identity to enc:ECL_02313)

MetaCyc: 87% identical to dipeptide/tripeptide:H+ symporter DtpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease DtpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>MPMX20_02004 Dipeptide and tripeptide permease A (Enterobacter sp. TBS_079)
MSTANNKPTDESVSLNAFKQPKAFYLIFSIELWERFGYYGLQGIMAVYLVKQLGMSEADS
ITLFSSFSALVYGLVAIGGWLGDKVLGTKRVIMLGAIVLAVGYALVAWSGHDAAVVYMGM
ATIAVGNGLFKANPSSLLSTCYNKDDPRLDGAFTMYYMSVNIGSFFSMLATPWLAAKFGW
SVAFSLSVVGMLITVVNFAFCKRWVKDYGSKPDFEPVHIGKLLATIVGVVILAAIATWLL
HNQGIARAVLGVVALGIVIIFAKEAFAMQGAARRKMIVAFILMLEAIIFFVLYSQMPTSL
NFFAIRNVEHSILGIAFEPEQYQALNPFWIMIGSPILAAIYNKMGDRLPMPHKFAIGMLL
CSGAFLVLPLGTKFATDAGIVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGFI
MGSWFLTTAGAAIIAGKIANLMAVPDNVTDPLVSLNVYGTVFMQIGIATAVIAVLMMLTA
PKLNRMTQDDDKTAKATETATA