Protein Info for MPMX20_02002 in Enterobacter sp. TBS_079

Annotation: Pyridoxal kinase PdxY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00687: pyridoxal kinase" amino acids 1 to 285 (285 residues), 465.1 bits, see alignment E=4.4e-144 PF08543: Phos_pyr_kin" amino acids 74 to 262 (189 residues), 59.4 bits, see alignment E=3.8e-20 PF00294: PfkB" amino acids 131 to 248 (118 residues), 39 bits, see alignment E=6.3e-14

Best Hits

Swiss-Prot: 92% identical to PDXY_ECO57: Pyridoxal kinase PdxY (pdxY) from Escherichia coli O157:H7

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 96% identity to enc:ECL_02315)

MetaCyc: 91% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX20_02002 Pyridoxal kinase PdxY (Enterobacter sp. TBS_079)
MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGQWTGCVMPPSHLT
DIVQGIANIDQLKRCDAILSGYLGSAEQGEHILGIVHQVKAANPAAKYFCDPVMGHPEKG
CIVAPGVAEFHVRHALPASDIIAPNLIELEILCEHPVNSVEEAVSASRELIAQGPEIVLV
KHLARAGLSRDRFEMLLVTKDEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATLR
DALEHVTAAVYEIMKATKEMQEYELQVVAAQDRIAKPEHYFSATRL